Example

>HSP100
MGNGGPGVERAQQQFRPEFLNRLDDIIVFRQLTEPQVRQIVDLDVTKINDRLFERHMELDLTDKAKDLLAEKGFDPLLGARPLRRVIQRDIEDTISEKILMGDLHDNERVIVDAEGDGILGEFTFRGEPFELPAAGEGDESKDVVPEPAAAASEAE
>HSP90
PEETQAQDQPMEEEEVEFAFIGYESDDKPEIEDYIDQEELNKTKPITNPDDITNEYGEFYSLTNDWEDLAVLGIHESQNRKHIYYITGETKEGLYLPEDEEEK
>HSP70
AAAGGSSCAKAPQTLTLVLASLPSSRSSSSHGADQGRGAGHRHRPRHHLLVRRRVAARPRRDHRQRPGQPHHALVRRLHRLGASHRRCAKNQVAMNPINTVFDANVLSAEGLLMPCQSDIKMWPYKVILA
>HSP60
MSTLTLNVSTVSPLGDRVFLKVNRAEEKTAGGILMPDTAQEKSQVGKVVSVGPGLRSGNGSYAPIDVQVGDQVLYAKYSGTDIKLGNEDYVLTKAQDILAIVT
>HSP40
MSGFCRAWFAKSPAARPAQGQFHDASEAGSVMNNYFRVLGVKSNASENDIKKAYRRLSNQYHPDKLHGASEEEKEQAALKLHQVKQAYEVLSDPKQRAAFIKDFNNVIVTDPAAAMQEMWDQFYP
>HSP20
MLSLLNKNRSFFDDFFEDFNVLNPVTTSNLMRTDIKETQNGYSLSVELPGFKKEDVKVSLEDGYLTIEAHTSKNSETKDQATKYIRKERYEGTMKRSYYVGNLHLDEINGTFENGMLHIELPKETKKEPEKRYLELK

 

NOTE:
(1) Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.

(2) If a query sequence contains any illegal character, wrong results will be obtained.

Close